PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009601500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 465aa    MW: 51745.3 Da    PI: 5.2052
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009601500.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-152269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l ++vk+ G g+W+++ r  g+ R++k+c++rw ++l
   XP_009601500.1 22 KGPWTATEDAILMEYVKKNGEGNWNAVQRNSGLMRCGKSCRLRWANHL 69
                     79******************************************9986 PP

2Myb_DNA-binding51.13.2e-1675118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++ eE+ ++v+++++lG++ W++ a+ m+ gRt++++k++w++
   XP_009601500.1  75 KGAFSLEEERIIVELHAKLGNK-WARMAAQMP-GRTDNEIKNYWNT 118
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5291769IPR017930Myb domain
SMARTSM007176.3E-122171IPR001005SANT/Myb domain
SuperFamilySSF466898.59E-2921116IPR009057Homeodomain-like
PfamPF002491.1E-132269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-222376IPR009057Homeodomain-like
CDDcd001679.66E-102469No hitNo description
PROSITE profilePS5129425.40970124IPR017930Myb domain
SMARTSM007171.2E-1574122IPR001005SANT/Myb domain
PfamPF002491.1E-1475118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2477123IPR009057Homeodomain-like
CDDcd001673.33E-1177120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MAPDGGGLKA RNNGGTRQVL KKGPWTATED AILMEYVKKN GEGNWNAVQR NSGLMRCGKS  60
CRLRWANHLR PNLKKGAFSL EEERIIVELH AKLGNKWARM AAQMPGRTDN EIKNYWNTRL  120
KRRQRAGLPI YPQDIQLQLN QQENQLQHST IPSPFDNNPQ NSNYINPPLS LLDIFNPSTM  180
KPSNISNQYQ FNNPSPYLTT TNNNNQLKLF RDPRVSLSLT LASSIRNSQL SSMVAPVPNN  240
FSQSYSNSMP VPPIQHNYPN FGSTTRPFTG IPSNPNGLIL GMGVQSSIPE TRICSRHTTS  300
SDDADNYAVD PGLSRGNSGL LEDLLEESQT LTRAEKIEEN CPIENHEASK GKLVWEEYGL  360
SEEAEDIILT EESTFSFAQQ GGEDATPIKH SEDSTSLNSS SGITTKEGSL ELANQVDEDI  420
MRFLDNFPVG VPVPDWCNDE NDQQNTSNGQ SFECDQIQSH CSKSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29201235107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1984990.0AF198499.1 Nicotiana tabacum anther-specific myb-related protein 1 (mybAS1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009601500.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLQ9FR420.0Q9FR42_TOBAC; Anther-specific myb-related protein 1
STRINGPGSC0003DMT4000360860.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.16e-71myb domain protein 101